MMP14/MT1-MMP Rabbit mAb, Clone: [ARC0211], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0067S
Article Name: MMP14/MT1-MMP Rabbit mAb, Clone: [ARC0211], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0067S
Supplier Catalog Number: CNA0067S
Alternative Catalog Number: MBL-CNA0067S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MMP14/MMP14/MT1-MMP (P50281).
Conjugation: Unconjugated
Alternative Names: MMP-14, MMP-X1, MT-MMP, MT1MMP, MTMMP1, WNCHRS, MT1-MMP, MT-MMP 1
Clonality: Monoclonal
Clone Designation: [ARC0211]
Molecular Weight: 66kDa
NCBI: 4323
UniProt: P50281
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLA
Target: MMP14
Application Dilute: WB: WB,1:500 - 1:2000