CAST Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0097S
Article Name: CAST Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0097S
Supplier Catalog Number: CNA0097S
Alternative Catalog Number: MBL-CNA0097S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human CAST (NP_001177371.1).
Conjugation: Unconjugated
Alternative Names: BS-17, PLACK
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 831
UniProt: P20810
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: TIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
Target: CAST
Application Dilute: WB: WB,1:200 - 1:2000|IHC-P,1:50 - 1:200