SERCA2/ATP2A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0098T
Article Name: SERCA2/ATP2A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0098T
Supplier Catalog Number: CNA0098T
Alternative Catalog Number: MBL-CNA0098T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 111-253 of human SERCA2/ATP2A2 (NP_733765.1).
Conjugation: Unconjugated
Alternative Names: DD, DAR, ATP2B, SERCA2
Clonality: Polyclonal
Molecular Weight: 115kDa
NCBI: 488
UniProt: P16615
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: NAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKL
Target: ATP2A2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100