MSP/MST1 Rabbit mAb, Clone: [ARC1809], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0109S
Article Name: MSP/MST1 Rabbit mAb, Clone: [ARC1809], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0109S
Supplier Catalog Number: CNA0109S
Alternative Catalog Number: MBL-CNA0109S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSP/MST1 (NP_066278.3).
Conjugation: Unconjugated
Alternative Names: MSP, HGFL, NF15S2, D3F15S2, DNF15S2
Clonality: Monoclonal
Clone Designation: [ARC1809]
Molecular Weight: 80kDa
NCBI: 4485
UniProt: P26927
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDL
Target: MST1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200