CCR7 Rabbit mAb, Clone: [ARC0231], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0121S
Article Name: CCR7 Rabbit mAb, Clone: [ARC0231], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0121S
Supplier Catalog Number: CNA0121S
Alternative Catalog Number: MBL-CNA0121S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR7 (P32248).
Conjugation: Unconjugated
Alternative Names: BLR2,EBI1,CCR-7,CD197,CDw197,CMKBR7,CC-CKR-7
Clonality: Monoclonal
Clone Designation: [ARC0231]
Molecular Weight: 43kDa
NCBI: 1236
UniProt: P32248
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL
Target: CCR7
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200