LRP5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0130P
Article Name: LRP5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0130P
Supplier Catalog Number: CNA0130P
Alternative Catalog Number: MBL-CNA0130P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1400-1500 of human LRP5 (NP_002326.2).
Conjugation: Unconjugated
Alternative Names: HBM, LR3, OPS, EVR1, EVR4, LRP7, OPPG, BMND1, LRP-5, LRP-7, OPTA1, PCLD4, VBCH2
Clonality: Polyclonal
Molecular Weight: 179kDa
NCBI: 4041
UniProt: O75197
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNP
Target: LRP5
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200