DUSP6 Rabbit mAb, Clone: [ARC0237], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0133S
Article Name: DUSP6 Rabbit mAb, Clone: [ARC0237], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0133S
Supplier Catalog Number: CNA0133S
Alternative Catalog Number: MBL-CNA0133S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 282-381 of human DUSP6 (Q16828).
Conjugation: Unconjugated
Alternative Names: HH19, MKP3, PYST1
Clonality: Monoclonal
Clone Designation: [ARC0237]
Molecular Weight: 42kDa
NCBI: 1848
UniProt: Q16828
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST
Target: DUSP6
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200