PGP9.5/UCHL1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0148S
| Article Name: |
PGP9.5/UCHL1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA0148S |
| Supplier Catalog Number: |
CNA0148S |
| Alternative Catalog Number: |
MBL-CNA0148S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 59-223 of human PGP9.5/PGP9.5/UCHL1 (NP_004172.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
NDGOA, PARK5, PGP95, SPG79, PGP9.5, SPG79A, UCHL-1, Uch-L1, HEL-117, PGP 9.5, HEL-S-53 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
25kDa |
| NCBI: |
7345 |
| UniProt: |
P09936 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
HENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA |
| Target: |
UCHL1 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
