PGP9.5/UCHL1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0148S
Article Name: |
PGP9.5/UCHL1 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA0148S |
Supplier Catalog Number: |
CNA0148S |
Alternative Catalog Number: |
MBL-CNA0148S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 59-223 of human PGP9.5/PGP9.5/UCHL1 (NP_004172.2). |
Conjugation: |
Unconjugated |
Alternative Names: |
NDGOA, PARK5, PGP95, SPG79, PGP9.5, SPG79A, UCHL-1, Uch-L1, HEL-117, PGP 9.5, HEL-S-53 |
Clonality: |
Polyclonal |
Molecular Weight: |
25kDa |
NCBI: |
7345 |
UniProt: |
P09936 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
HENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA |
Target: |
UCHL1 |
Application Dilute: |
WB: WB,1:500 - 1:2000 |