RACK1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0151S
| Article Name: |
RACK1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA0151S |
| Supplier Catalog Number: |
CNA0151S |
| Alternative Catalog Number: |
MBL-CNA0151S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human RACK1 (NP_006089.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
H12.3, HLC-7, PIG21, GNB2L1, Gnb2-rs1 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
35kDa |
| NCBI: |
10399 |
| UniProt: |
P63244 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
MILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEP |
| Target: |
RACK1 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
