ALDH1A1 Rabbit mAb, Clone: [ARC52440], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0157P
Article Name: ALDH1A1 Rabbit mAb, Clone: [ARC52440], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0157P
Supplier Catalog Number: CNA0157P
Alternative Catalog Number: MBL-CNA0157P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALDH1A1 (NP_000680.2).
Conjugation: Unconjugated
Alternative Names: ALDC, ALDH1, HEL-9, HEL12, PUMB1, ALDH11, RALDH1, ALDH-E1, HEL-S-53e
Clonality: Monoclonal
Clone Designation: [ARC52440]
Molecular Weight: 55kDa
NCBI: 216
UniProt: P00352
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: VGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
Target: ALDH1A1
Application Dilute: WB: WB,1:10000 - 1:120000|IF/ICC,1:500 - 1:1000|IP,1:500 - 1:1000