Rad50 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0182S
| Article Name: |
Rad50 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA0182S |
| Supplier Catalog Number: |
CNA0182S |
| Alternative Catalog Number: |
MBL-CNA0182S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Rad50 (Q92878). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
NBSLD, RAD502, hRad50 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
154kDa |
| NCBI: |
10111 |
| UniProt: |
Q92878 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
TDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLV |
| Target: |
RAD50 |
| Application Dilute: |
WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100 |
