QKI Rabbit mAb, Clone: [ARC2500], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0193S
Article Name: QKI Rabbit mAb, Clone: [ARC2500], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0193S
Supplier Catalog Number: CNA0193S
Alternative Catalog Number: MBL-CNA0193S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 242-341 of human QKI (Q96PU8).
Conjugation: Unconjugated
Alternative Names: QK, Hqk, QK1, QK3, hqkI
Clonality: Monoclonal
Clone Designation: [ARC2500]
Molecular Weight: 38kDa
NCBI: 9444
UniProt: Q96PU8
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: RTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
Target: QKI
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000