CaMKII Rabbit mAb, Clone: [ARC1814], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0198P
Article Name: CaMKII Rabbit mAb, Clone: [ARC1814], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0198P
Supplier Catalog Number: CNA0198P
Alternative Catalog Number: MBL-CNA0198P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMKII (NP_741960.1).
Conjugation: Unconjugated
Alternative Names: CAM2, CAMK2, CAMKB, MRD54, CaMKIIbeta
Clonality: Monoclonal
Clone Designation: [ARC1814]
Molecular Weight: 73kDa
NCBI: 816
UniProt: Q13554
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: GVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
Target: CAMK2B
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:50 - 1:200