Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA0200S
• Supplier Catalog Number: CNA0200S
• Alternative Catalog Number: MBL-CNA0200S
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 360-609 of human Alpha-Fetoprotein (Alpha-Fetoprotein (AFP)) (NP_001125.1).
• Conjugation: Unconjugated
• Alternative Names: AFPD, FETA, HPAFP

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 69kDa
• NCBI: 174
• UniProt: P02771
• Buffer: PBS with 0.02% sodium azide,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.02% sodium azide,50% glycerol
• Sequence: RRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
• Target: AFP

Application Notes

• Application Dilute: WB: WB,1:500 - 1:1000