ATF4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0201S
Article Name: ATF4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0201S
Supplier Catalog Number: CNA0201S
Alternative Catalog Number: MBL-CNA0201S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-351 of human ATF4 (NP_001666.2).
Conjugation: Unconjugated
Alternative Names: CREB2, TXREB, CREB-2, TAXREB67
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 468
UniProt: P18848
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCG
Target: ATF4
Application Dilute: WB: WB,1:500 - 1:2000