ATF6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0202P
Article Name: ATF6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0202P
Supplier Catalog Number: CNA0202P
Alternative Catalog Number: MBL-CNA0202P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human ATF6 (NP_031374.2).
Conjugation: Unconjugated
Alternative Names: ACHM7, ATF6A
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 22926
UniProt: P18850
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAP
Target: ATF6
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IHC-P,1:50 - 1:200