Bid Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0210P
Article Name: Bid Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0210P
Supplier Catalog Number: CNA0210P
Alternative Catalog Number: MBL-CNA0210P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human Bid (NP_001187.1).
Conjugation: Unconjugated
Alternative Names: FP497
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 637
UniProt: P55957
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Target: BID
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200