Caspase-3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0214P
Article Name: Caspase-3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0214P
Supplier Catalog Number: CNA0214P
Alternative Catalog Number: MBL-CNA0214P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 55-160 of human Caspase-3 (P42574).
Conjugation: Unconjugated
Alternative Names: CPP32, SCA-1, CPP32B
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 836
UniProt: P42574
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: FHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII
Target: CASP3
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:300