Fas Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0233S
Article Name: Fas Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0233S
Supplier Catalog Number: CNA0233S
Alternative Catalog Number: MBL-CNA0233S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 61-335 of human Fas (NP_000034.1).
Conjugation: Unconjugated
Alternative Names: APT1, CD95, FAS1, APO-1, FASTM, ALPS1A, TNFRSF6
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 355
UniProt: P25445
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTII
Target: FAS
Application Dilute: WB: WB,1:500 - 1:1000