FasLG Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0234S
Article Name: FasLG Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0234S
Supplier Catalog Number: CNA0234S
Alternative Catalog Number: MBL-CNA0234S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FasLG (NP_000630.1).
Conjugation: Unconjugated
Alternative Names: APTL, FASL, CD178, CD95L, ALPS1B, CD95-L, TNFSF6, TNLG1A, APT1LG1
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 356
UniProt: P48023
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQ
Target: FASLG
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200