GFAP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0237T
Article Name: GFAP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0237T
Supplier Catalog Number: CNA0237T
Alternative Catalog Number: MBL-CNA0237T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-432 of human GFAP (NP_002046.1).
Conjugation: Unconjugated
Alternative Names: ALXDRD
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 2670
UniProt: P14136
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: QDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
Target: GFAP
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200