BiP/GRP78 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0241S
Article Name: BiP/GRP78 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0241S
Supplier Catalog Number: CNA0241S
Alternative Catalog Number: MBL-CNA0241S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human BiP/GRP78 (NP_005338.1).
Conjugation: Unconjugated
Alternative Names: BIP, GRP78, HEL-S-89n
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 3309
UniProt: P11021
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: EEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAE
Target: HSPA5
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200