Cytokeratin 19 (KRT19) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0247S
Article Name: Cytokeratin 19 (KRT19) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0247S
Supplier Catalog Number: CNA0247S
Alternative Catalog Number: MBL-CNA0247S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 241-400 of human Cytokeratin 19 (Cytokeratin 19 (KRT19)) (NP_002267.2).
Conjugation: Unconjugated
Alternative Names: K19, CK19, K1CS
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 3880
UniProt: P08727
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Target: KRT19
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200