MEK2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0253S
Article Name: MEK2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0253S
Supplier Catalog Number: CNA0253S
Alternative Catalog Number: MBL-CNA0253S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK2 (NP_109587.1).
Conjugation: Unconjugated
Alternative Names: CFC4, MEK2, MKK2, MAPKK2, PRKMK2
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 5605
UniProt: P36507
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMAR
Target: MAP2K2
Application Dilute: WB: WB,1:500 - 1:2000