MTM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0255P
Article Name: MTM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0255P
Supplier Catalog Number: CNA0255P
Alternative Catalog Number: MBL-CNA0255P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 484-603 of human MTM1 (NP_000243.1).
Conjugation: Unconjugated
Alternative Names: CNM, CNMX, MTMX, XLMTM
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 4534
UniProt: Q13496
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SARERQKVTERTVSLWSLINSNKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPPTSPSSPSQMMPHVQTHF
Target: MTM1
Application Dilute: WB: WB,1:500 - 1:1000