PBEF/Visfatin/NAMPT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0256P
Article Name: PBEF/Visfatin/NAMPT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0256P
Supplier Catalog Number: CNA0256P
Alternative Catalog Number: MBL-CNA0256P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 181-382 of human PBEF/Visfatin/NAMPT (NP_005737.1).
Conjugation: Unconjugated
Alternative Names: VF, PBEF, PBEF1, VISFATIN, 1110035O14Rik
Clonality: Polyclonal
Molecular Weight: 56kDa
Sensitivity: 1.33 mg/mL
NCBI: 10135
UniProt: P43490
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIAFGS
Target: NAMPT
Application Dilute: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200