NME1/NM23A Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NME1/NM23A Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA0259T
• Supplier Catalog Number: CNA0259T
• Alternative Catalog Number: MBL-CNA0259T
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human NME1/NM23A (NP_000260.1).
• Conjugation: Unconjugated
• Alternative Names: NB, AWD, NBS, GAAD, NDKA, NM23, NDPKA, NDPK-A, NM23-H1

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 17kDa
• NCBI: 4830
• UniProt: P15531
• Buffer: PBS with 0.01% thimerosal,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.01% thimerosal,50% glycerol
• Sequence: KPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
• Target: NME1

Application Notes

• Application Dilute: WB: IHC-P,1:50 - 1:200