OLFM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0261S
Article Name: OLFM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0261S
Supplier Catalog Number: CNA0261S
Alternative Catalog Number: MBL-CNA0261S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-220 of human OLFM1 (NP_055094.1).
Conjugation: Unconjugated
Alternative Names: AMY, NOE1, OlfA, NOELIN1
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 10439
UniProt: Q99784
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: IEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQFKEEVQNLTSVLNELQEEIGAYDYDELQSRVSNLEERLRACMQKLACGKLTGISDPVT
Target: OLFM1
Application Dilute: WB: WB,1:500 - 1:2000