PCNA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0264P
Article Name: PCNA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0264P
Supplier Catalog Number: CNA0264P
Alternative Catalog Number: MBL-CNA0264P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1).
Conjugation: Unconjugated
Alternative Names: ATLD2
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 5111
UniProt: P12004
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Target: PCNA
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200