PIK3CG Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0266S
| Article Name: |
PIK3CG Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA0266S |
| Supplier Catalog Number: |
CNA0266S |
| Alternative Catalog Number: |
MBL-CNA0266S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-310 of human PIK3CG (NP_002640.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
PI3K, PIK3, IMD97, PI3CG, PI3Kgamma, p110gamma, p120-PI3K |
| Clonality: |
Polyclonal |
| Molecular Weight: |
126kDa |
| NCBI: |
5294 |
| UniProt: |
P48736 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAK |
| Target: |
PIK3CG |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
