PIK3CG Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0266S
Article Name: |
PIK3CG Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA0266S |
Supplier Catalog Number: |
CNA0266S |
Alternative Catalog Number: |
MBL-CNA0266S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-310 of human PIK3CG (NP_002640.2). |
Conjugation: |
Unconjugated |
Alternative Names: |
PI3K, PIK3, IMD97, PI3CG, PI3Kgamma, p110gamma, p120-PI3K |
Clonality: |
Polyclonal |
Molecular Weight: |
126kDa |
NCBI: |
5294 |
UniProt: |
P48736 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAK |
Target: |
PIK3CG |
Application Dilute: |
WB: WB,1:500 - 1:2000 |