PKC alpha Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0267P
Article Name: PKC alpha Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0267P
Supplier Catalog Number: CNA0267P
Alternative Catalog Number: MBL-CNA0267P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 573-672 of human PKC alpha (NP_002728.2).
Conjugation: Unconjugated
Alternative Names: AAG6, PKCA, PRKACA, PKCI+/-, PKCalpha, PKC-alpha
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 5578
UniProt: P17252
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Target: PRKCA
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200