POLR1C Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0269S
| Article Name: |
POLR1C Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA0269S |
| Supplier Catalog Number: |
CNA0269S |
| Alternative Catalog Number: |
MBL-CNA0269S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR1C (NP_976035.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
AC40, RPA5, TCS3, HLD11, RPA39, RPA40, RPAC1, RPC40 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
39kDa |
| NCBI: |
9533 |
| UniProt: |
O15160 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIA |
| Target: |
POLR1C |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
