POLR1C Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0269S
Article Name: |
POLR1C Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA0269S |
Supplier Catalog Number: |
CNA0269S |
Alternative Catalog Number: |
MBL-CNA0269S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR1C (NP_976035.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
AC40, RPA5, TCS3, HLD11, RPA39, RPA40, RPAC1, RPC40 |
Clonality: |
Polyclonal |
Molecular Weight: |
39kDa |
NCBI: |
9533 |
UniProt: |
O15160 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIA |
Target: |
POLR1C |
Application Dilute: |
WB: WB,1:500 - 1:2000 |