TNF-alpha Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0277P
Article Name: TNF-alpha Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0277P
Supplier Catalog Number: CNA0277P
Alternative Catalog Number: MBL-CNA0277P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNF (NP_000585.2).
Conjugation: Unconjugated
Alternative Names: DIF, TNFA, TNFSF2, TNLG1F, TNF-alpha
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 7124
UniProt: P01375
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEG
Target: TNF
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200