VCAM1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0279P
| Article Name: |
VCAM1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA0279P |
| Supplier Catalog Number: |
CNA0279P |
| Alternative Catalog Number: |
MBL-CNA0279P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human VCAM1 (NP_001069.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CD106, INCAM-100 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
81kDa |
| NCBI: |
7412 |
| UniProt: |
P19320 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
NRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVEL |
| Target: |
VCAM1 |
| Application Dilute: |
WB: WB,1:100 - 1:500 |
