VEGFA Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: VEGFA Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA0280S1
• Supplier Catalog Number: CNA0280S1
• Alternative Catalog Number: MBL-CNA0280S1
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-191 of human VEGFA (NP_001165097.1).
• Conjugation: Unconjugated
• Alternative Names: VPF, VEGF, MVCD1

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 27kDa
• NCBI: 7422
• UniProt: P15692
• Buffer: PBS with 0.09% Sodium azide,50% glycerol
• Source: Rabbit
• Sequence: SNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Target: VEGFA

Application Notes

• Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200