Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0287S
Article Name: Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0287S
Supplier Catalog Number: CNA0287S
Alternative Catalog Number: MBL-CNA0287S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1130-1230 of human Insulin Receptor (NP_000199.2).
Conjugation: Unconjugated
Alternative Names: HHF5, CD220
Clonality: Polyclonal
Molecular Weight: 156kDa
NCBI: 3643
UniProt: P06213
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEIT
Target: INSR
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100