JNK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0288P
Article Name: JNK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0288P
Supplier Catalog Number: CNA0288P
Alternative Catalog Number: MBL-CNA0288P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 245-345 of human JNK1 (NP_620635.1).
Conjugation: Unconjugated
Alternative Names: JNK, JNK1, PRKM8, SAPK1, JNK-46, JNK1A2, SAPK1c, JNK21B1/2
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 5599
UniProt: P45983
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: CPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDER
Target: MAPK8
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200