[KO Validated] CDK2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0294T
Article Name: [KO Validated] CDK2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0294T
Supplier Catalog Number: CNA0294T
Alternative Catalog Number: MBL-CNA0294T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-298 of human CDK2 (NP_001789.2).
Conjugation: Unconjugated
Alternative Names: CDKN2, p33(CDK2)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 1017
UniProt: P24941
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Target: CDK2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200