ESRalpha Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0296P
Article Name: ESRalpha Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0296P
Supplier Catalog Number: CNA0296P
Alternative Catalog Number: MBL-CNA0296P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence within amino acids 516-595 of human ESRalpha (NP_000116.2).
Conjugation: Unconjugated
Alternative Names: ER, ESR, Era, ESRA, ESTRR, NR3A1
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 2099
UniProt: P03372
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: HMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Target: ESR1
Application Dilute: WB: WB,1:100 - 1:500