RYR2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0298P
Article Name: RYR2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0298P
Supplier Catalog Number: CNA0298P
Alternative Catalog Number: MBL-CNA0298P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 4200-4300 of human RYR2 (NP_001026.2).
Conjugation: Unconjugated
Alternative Names: RyR, ARVC2, ARVD2, RYR-2, VTSIP, VACRDS
Clonality: Polyclonal
Molecular Weight: 565kDa
NCBI: 6262
UniProt: Q92736
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MQLAAQISESDLNERSANKEESEKERPEEQGPRMAFFSILTVRSALFALRYNILTLMRMLSLKSLKKQMKKVKKMTVKDMVTAFFSSYWSIFMTLLHFVAS
Target: RYR2
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200