CRM1/XPO1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0299P
Article Name: |
CRM1/XPO1 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA0299P |
Supplier Catalog Number: |
CNA0299P |
Alternative Catalog Number: |
MBL-CNA0299P |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human CRM1/CRM1/XPO1 (NP_003391.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
emb, CRM1, exp1, CRM-1 |
Clonality: |
Polyclonal |
Molecular Weight: |
123kDa |
NCBI: |
7514 |
UniProt: |
O14980 |
Buffer: |
PBS with 0.05% proclin300,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.05% proclin300,50% glycerol |
Sequence: |
GLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD |
Target: |
XPO1 |
Application Dilute: |
WB: WB,1:500 - 1:1000 |