APOE Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0304P
Article Name: APOE Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0304P
Supplier Catalog Number: CNA0304P
Alternative Catalog Number: MBL-CNA0304P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 41-307 of human APOE (NP_000032.1).
Conjugation: Unconjugated
Alternative Names: AD2, LPG, APO-E, ApoE4, LDLCQ5
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 348
UniProt: P02649
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQW
Target: APOE
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200