CD79a Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CD79a Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA0331T
• Supplier Catalog Number: CNA0331T
• Alternative Catalog Number: MBL-CNA0331T
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1).
• Conjugation: Unconjugated
• Alternative Names: IGA, MB1, MB-1, IGAlpha

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 25kDa
• NCBI: 973
• UniProt: P11912
• Buffer: PBS with 0.01% thimerosal,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.01% thimerosal,50% glycerol
• Sequence: FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
• Target: CD79A

Application Notes

• Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200