TGFA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0337S
Article Name: TGFA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0337S
Supplier Catalog Number: CNA0337S
Alternative Catalog Number: MBL-CNA0337S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human TGFA (NP_001093161.1).
Conjugation: Unconjugated
Alternative Names: TFGA
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 7039
UniProt: P01135
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: ENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQA
Target: TGFA
Application Dilute: WB: WB,1:100 - 1:500