ACHA4 Rabbit mAb, Clone: [ARC1822], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0350S
Article Name: ACHA4 Rabbit mAb, Clone: [ARC1822], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0350S
Supplier Catalog Number: CNA0350S
Alternative Catalog Number: MBL-CNA0350S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ACHA4 (P43681).
Conjugation: Unconjugated
Alternative Names: EBN, BFNC, EBN1, NACHR, NACRA4, NACHRA4
Clonality: Monoclonal
Clone Designation: [ARC1822]
Molecular Weight: 70kDa
NCBI: 1137
UniProt: P43681
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR
Target: CHRNA4
Application Dilute: WB: WB,1:500 - 1:1000