CD117/c-Kit Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0357P
Article Name: CD117/c-Kit Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0357P
Supplier Catalog Number: CNA0357P
Alternative Catalog Number: MBL-CNA0357P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 867-976 of human KIT (P10721).
Conjugation: Unconjugated
Alternative Names: PBT, SCFR, C-Kit, CD117, MASTC
Clonality: Polyclonal
Molecular Weight: 110kDa
NCBI: 3815
UniProt: P10721
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: VDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV
Target: KIT
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200