RARalpha Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0370T
Article Name: RARalpha Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0370T
Supplier Catalog Number: CNA0370T
Alternative Catalog Number: MBL-CNA0370T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-457 of human RARalpha (NP_001019980.1).
Conjugation: Unconjugated
Alternative Names: RAR, NR1B1, RARalpha
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 5914
UniProt: P10276
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MYESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQIT
Target: RARA
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200