VHL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0377P
Article Name: VHL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0377P
Supplier Catalog Number: CNA0377P
Alternative Catalog Number: MBL-CNA0377P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 58-170 of VHL (NP_000542.1).
Conjugation: Unconjugated
Alternative Names: RCA1, VHL1, pVHL, HRCA1
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 7428
UniProt: P40337
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: RPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLV
Target: VHL
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200