CD31/PECAM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0378P
Article Name: CD31/PECAM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0378P
Supplier Catalog Number: CNA0378P
Alternative Catalog Number: MBL-CNA0378P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM (NP_000433.4).
Conjugation: Unconjugated
Alternative Names: CD31, PECA1, GPIIA, PECAM-1, endoCAM, CD31/EndoCAM
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 5175
UniProt: P16284
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Target: PECAM1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200