TP73 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0385T
Article Name: TP73 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0385T
Supplier Catalog Number: CNA0385T
Alternative Catalog Number: MBL-CNA0385T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 487-636 of human TP73 (NP_005418.1).
Conjugation: Unconjugated
Alternative Names: P73, CILD47
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 7161
UniProt: O15350
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
Target: TP73
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200